VEGFR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0058T
Artikelname: VEGFR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0058T
Hersteller Artikelnummer: CNA0058T
Alternativnummer: MBL-CNA0058T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1100-1180 of human VEGFR1 (NP_002010.2).
Konjugation: Unconjugated
Alternative Synonym: FLT, FLT-1, VEGFR1, VEGFR-1
Klonalität: Polyclonal
Molekulargewicht: 151kDa
NCBI: 2321
UniProt: P17948
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNS
Target-Kategorie: FLT1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200