CYP1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0062S
Artikelname: CYP1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0062S
Hersteller Artikelnummer: CNA0062S
Alternativnummer: MBL-CNA0062S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2).
Konjugation: Unconjugated
Alternative Synonym: CP12, CYPIA2, P3-450, P450(PA)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 1544
UniProt: P05177
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE
Target-Kategorie: CYP1A2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200