MMP14/MT1-MMP Rabbit mAb, Clone: [ARC0211], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0067S
Artikelname: MMP14/MT1-MMP Rabbit mAb, Clone: [ARC0211], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0067S
Hersteller Artikelnummer: CNA0067S
Alternativnummer: MBL-CNA0067S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (P50281).
Konjugation: Unconjugated
Alternative Synonym: MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0211]
Molekulargewicht: 66kDa
NCBI: 4323
UniProt: P50281
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA
Target-Kategorie: MMP14
Application Verdünnung: WB: WB,1:500 - 1:2000