[KO Validated] CDK2 Rabbit mAb, Clone: [ARC0222], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA0094S
| Artikelname: |
[KO Validated] CDK2 Rabbit mAb, Clone: [ARC0222], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA0094S |
| Hersteller Artikelnummer: |
CNA0094S |
| Alternativnummer: |
MBL-CNA0094S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 199-298 of human CDK2 (P24941). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CDKN2, p33(CDK2) |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0222] |
| Molekulargewicht: |
34kDa |
| Sensitivitaet: |
1.2 mg/mL |
| NCBI: |
1017 |
| UniProt: |
P24941 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL |
| Target-Kategorie: |
CDK2 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
