CAST Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0097S
Artikelname: CAST Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0097S
Hersteller Artikelnummer: CNA0097S
Alternativnummer: MBL-CNA0097S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human CAST (NP_001177371.1).
Konjugation: Unconjugated
Alternative Synonym: BS-17, PLACK
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 831
UniProt: P20810
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
Target-Kategorie: CAST
Application Verdünnung: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200