DUSP6 Rabbit mAb, Clone: [ARC0237], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0133S
Artikelname: DUSP6 Rabbit mAb, Clone: [ARC0237], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0133S
Hersteller Artikelnummer: CNA0133S
Alternativnummer: MBL-CNA0133S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 282-381 of human DUSP6 (Q16828).
Konjugation: Unconjugated
Alternative Synonym: HH19, MKP3, PYST1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0237]
Molekulargewicht: 42kDa
NCBI: 1848
UniProt: Q16828
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
Target-Kategorie: DUSP6
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200