PGP9.5/UCHL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0148S
Artikelname: PGP9.5/UCHL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0148S
Hersteller Artikelnummer: CNA0148S
Alternativnummer: MBL-CNA0148S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2).
Konjugation: Unconjugated
Alternative Synonym: NDGOA, PARK5, PGP95, SPG79, PGP9.5, SPG79A, UCHL-1, Uch-L1, HEL-117, PGP 9.5, HEL-S-53
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 7345
UniProt: P09936
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
Target-Kategorie: UCHL1
Application Verdünnung: WB: WB,1:500 - 1:2000