RACK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0151S
Artikelname: RACK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0151S
Hersteller Artikelnummer: CNA0151S
Alternativnummer: MBL-CNA0151S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human RACK1 (NP_006089.1).
Konjugation: Unconjugated
Alternative Synonym: H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 10399
UniProt: P63244
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEP
Target-Kategorie: RACK1
Application Verdünnung: WB: WB,1:500 - 1:2000