Rad50 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0182S
Artikelname: Rad50 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0182S
Hersteller Artikelnummer: CNA0182S
Alternativnummer: MBL-CNA0182S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Rad50 (Q92878).
Konjugation: Unconjugated
Alternative Synonym: NBSLD, RAD502, hRad50
Klonalität: Polyclonal
Molekulargewicht: 154kDa
NCBI: 10111
UniProt: Q92878
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLV
Target-Kategorie: RAD50
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100