CaMKII Rabbit mAb, Clone: [ARC1814], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0198P
Artikelname: CaMKII Rabbit mAb, Clone: [ARC1814], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0198P
Hersteller Artikelnummer: CNA0198P
Alternativnummer: MBL-CNA0198P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1).
Konjugation: Unconjugated
Alternative Synonym: CAM2, CAMK2, CAMKB, MRD54, CaMKIIbeta
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1814]
Molekulargewicht: 73kDa
NCBI: 816
UniProt: Q13554
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
Target-Kategorie: CAMK2B
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200