Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0200S
Artikelname: Alpha-Fetoprotein (AFP) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0200S
Hersteller Artikelnummer: CNA0200S
Alternativnummer: MBL-CNA0200S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-609 of human Alpha-Fetoprotein (Alpha-Fetoprotein (AFP)) (NP_001125.1).
Konjugation: Unconjugated
Alternative Synonym: AFPD, FETA, HPAFP
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 174
UniProt: P02771
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Target-Kategorie: AFP
Application Verdünnung: WB: WB,1:500 - 1:1000