Bcl-2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0208P
Artikelname: Bcl-2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0208P
Hersteller Artikelnummer: CNA0208P
Alternativnummer: MBL-CNA0208P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (NP_000624.2).
Konjugation: Unconjugated
Alternative Synonym: Bcl-2, PPP1R50
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 596
UniProt: P10415
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
Target-Kategorie: BCL2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000