Bid Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0210P
Artikelname: Bid Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0210P
Hersteller Artikelnummer: CNA0210P
Alternativnummer: MBL-CNA0210P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Bid (NP_001187.1).
Konjugation: Unconjugated
Alternative Synonym: FP497
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 637
UniProt: P55957
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Target-Kategorie: BID
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200