Caspase-3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0214P
Artikelname: Caspase-3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0214P
Hersteller Artikelnummer: CNA0214P
Alternativnummer: MBL-CNA0214P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574).
Konjugation: Unconjugated
Alternative Synonym: CPP32, SCA-1, CPP32B
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 836
UniProt: P42574
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
Target-Kategorie: CASP3
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:300