Caspase-10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0216S
Artikelname: Caspase-10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0216S
Hersteller Artikelnummer: CNA0216S
Alternativnummer: MBL-CNA0216S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-521 of human Caspase-10 (NP_116759.2).
Konjugation: Unconjugated
Alternative Synonym: MCH4, ALPS2, FLICE2, FLICE-2
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 843
UniProt: Q92851
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRH
Target-Kategorie: CASP10
Application Verdünnung: WB: WB,1:500 - 1:1000