CD133 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0219T
Artikelname: CD133 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0219T
Hersteller Artikelnummer: CNA0219T
Alternativnummer: MBL-CNA0219T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 750-850 of human CD133 (NP_006008.1).
Konjugation: Unconjugated
Alternative Synonym: RP41, AC133, CD133, MCDR2, STGD4, CORD12, PROML1, MSTP061
Klonalität: Polyclonal
Molekulargewicht: 97kDa
Sensitivitaet: 0.24 mg/mL
NCBI: 8842
UniProt: O43490
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDH
Target-Kategorie: PROM1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200