Raf1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0223S
Artikelname: Raf1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0223S
Hersteller Artikelnummer: CNA0223S
Alternativnummer: MBL-CNA0223S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 190-350 of human Raf1 (NP_002871.1).
Konjugation: Unconjugated
Alternative Synonym: NS5, CRAF, Raf-1, c-Raf, CMD1NN
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 5894
UniProt: P04049
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVM
Target-Kategorie: RAF1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200