[KO Validated] Cytochrome C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0225P
Artikelname: [KO Validated] Cytochrome C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0225P
Hersteller Artikelnummer: CNA0225P
Alternativnummer: MBL-CNA0225P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human Cytochrome C (NP_061820.1).
Konjugation: Unconjugated
Alternative Synonym: CYC, HCS, THC4
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 54205
UniProt: P99999
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Target-Kategorie: CYCS
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200