FasLG Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0234S
Artikelname: FasLG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0234S
Hersteller Artikelnummer: CNA0234S
Alternativnummer: MBL-CNA0234S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FasLG (NP_000630.1).
Konjugation: Unconjugated
Alternative Synonym: APTL, FASL, CD178, CD95L, ALPS1B, CD95-L, TNFSF6, TNLG1A, APT1LG1
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 356
UniProt: P48023
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQ
Target-Kategorie: FASLG
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200