GFAP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0237T
Artikelname: GFAP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0237T
Hersteller Artikelnummer: CNA0237T
Alternativnummer: MBL-CNA0237T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-432 of human GFAP (NP_002046.1).
Konjugation: Unconjugated
Alternative Synonym: ALXDRD
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 2670
UniProt: P14136
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Target-Kategorie: GFAP
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200