BiP/GRP78 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0241S
Artikelname: BiP/GRP78 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0241S
Hersteller Artikelnummer: CNA0241S
Alternativnummer: MBL-CNA0241S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human BiP/GRP78 (NP_005338.1).
Konjugation: Unconjugated
Alternative Synonym: BIP, GRP78, HEL-S-89n
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 3309
UniProt: P11021
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAE
Target-Kategorie: HSPA5
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200