IRS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0245P
Artikelname: IRS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0245P
Hersteller Artikelnummer: CNA0245P
Alternativnummer: MBL-CNA0245P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1043-1242 of human IRS1 (P35568).
Konjugation: Unconjugated
Alternative Synonym: HIRS-1
Klonalität: Polyclonal
Molekulargewicht: 132kDa
NCBI: 3667
UniProt: P35568
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
Target-Kategorie: IRS1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200