MDK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0251T
Artikelname: MDK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0251T
Hersteller Artikelnummer: CNA0251T
Alternativnummer: MBL-CNA0251T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-129 of human MDK (NP_002382.1).
Konjugation: Unconjugated
Alternative Synonym: MK, ARAP, NEGF2
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 4192
UniProt: P21741
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPK
Target-Kategorie: MDK
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200