MEK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0253S
Artikelname: MEK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0253S
Hersteller Artikelnummer: CNA0253S
Alternativnummer: MBL-CNA0253S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1).
Konjugation: Unconjugated
Alternative Synonym: CFC4, MEK2, MKK2, MAPKK2, PRKMK2
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 5605
UniProt: P36507
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR
Target-Kategorie: MAP2K2
Application Verdünnung: WB: WB,1:500 - 1:2000