MTM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0255P
Artikelname: MTM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0255P
Hersteller Artikelnummer: CNA0255P
Alternativnummer: MBL-CNA0255P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 484-603 of human MTM1 (NP_000243.1).
Konjugation: Unconjugated
Alternative Synonym: CNM, CNMX, MTMX, XLMTM
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 4534
UniProt: Q13496
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF
Target-Kategorie: MTM1
Application Verdünnung: WB: WB,1:500 - 1:1000