NME1/NM23A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0259T
Artikelname: NME1/NM23A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0259T
Hersteller Artikelnummer: CNA0259T
Alternativnummer: MBL-CNA0259T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human NME1/NM23A (NP_000260.1).
Konjugation: Unconjugated
Alternative Synonym: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 4830
UniProt: P15531
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Target-Kategorie: NME1
Application Verdünnung: WB: IHC-P,1:50 - 1:200