OLFM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0261S
Artikelname: OLFM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0261S
Hersteller Artikelnummer: CNA0261S
Alternativnummer: MBL-CNA0261S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human OLFM1 (NP_055094.1).
Konjugation: Unconjugated
Alternative Synonym: AMY, NOE1, OlfA, NOELIN1
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 10439
UniProt: Q99784
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVT
Target-Kategorie: OLFM1
Application Verdünnung: WB: WB,1:500 - 1:2000