PCNA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0264P
Artikelname: PCNA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0264P
Hersteller Artikelnummer: CNA0264P
Alternativnummer: MBL-CNA0264P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1).
Konjugation: Unconjugated
Alternative Synonym: ATLD2
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 5111
UniProt: P12004
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Target-Kategorie: PCNA
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200