POLR1C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0269S
Artikelname: POLR1C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0269S
Hersteller Artikelnummer: CNA0269S
Alternativnummer: MBL-CNA0269S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human POLR1C (NP_976035.1).
Konjugation: Unconjugated
Alternative Synonym: AC40, RPA5, TCS3, HLD11, RPA39, RPA40, RPAC1, RPC40
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 9533
UniProt: O15160
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA
Target-Kategorie: POLR1C
Application Verdünnung: WB: WB,1:500 - 1:2000