TNF-alpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0277P
Artikelname: TNF-alpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0277P
Hersteller Artikelnummer: CNA0277P
Alternativnummer: MBL-CNA0277P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNF (NP_000585.2).
Konjugation: Unconjugated
Alternative Synonym: DIF, TNFA, TNFSF2, TNLG1F, TNF-alpha
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 7124
UniProt: P01375
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEG
Target-Kategorie: TNF
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200