VCAM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0279P
Artikelname: VCAM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0279P
Hersteller Artikelnummer: CNA0279P
Alternativnummer: MBL-CNA0279P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human VCAM1 (NP_001069.1).
Konjugation: Unconjugated
Alternative Synonym: CD106, INCAM-100
Klonalität: Polyclonal
Molekulargewicht: 81kDa
NCBI: 7412
UniProt: P19320
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: NRKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL
Target-Kategorie: VCAM1
Application Verdünnung: WB: WB,1:100 - 1:500