VEGFA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0280S1
Artikelname: VEGFA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0280S1
Hersteller Artikelnummer: CNA0280S1
Alternativnummer: MBL-CNA0280S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-191 of human VEGFA (NP_001165097.1).
Konjugation: Unconjugated
Alternative Synonym: VPF, VEGF, MVCD1
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 7422
UniProt: P15692
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Target-Kategorie: VEGFA
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200