Interferon alpha 1 (IFN-alpha1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0285P
Artikelname: Interferon alpha 1 (IFN-alpha1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0285P
Hersteller Artikelnummer: CNA0285P
Alternativnummer: MBL-CNA0285P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-189 of human Interferon alpha 1 (IFN-alpha1) (NP_076918.1).
Konjugation: Unconjugated
Alternative Synonym: IFL, IFN, IFNA , IFNA13, leIF D, IFN-ALPHA, IFN-alphaD
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 3439
UniProt: P01562
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Target-Kategorie: IFNA1
Application Verdünnung: WB: WB,1:500 - 1:1000