Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0287S
Artikelname: Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0287S
Hersteller Artikelnummer: CNA0287S
Alternativnummer: MBL-CNA0287S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1130-1230 of human Insulin Receptor (NP_000199.2).
Konjugation: Unconjugated
Alternative Synonym: HHF5, CD220
Klonalität: Polyclonal
Molekulargewicht: 156kDa
NCBI: 3643
UniProt: P06213
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEIT
Target-Kategorie: INSR
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100