JNK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0288P
Artikelname: JNK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0288P
Hersteller Artikelnummer: CNA0288P
Alternativnummer: MBL-CNA0288P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human JNK1 (NP_620635.1).
Konjugation: Unconjugated
Alternative Synonym: JNK, JNK1, PRKM8, SAPK1, JNK-46, JNK1A2, SAPK1c, JNK21B1/2
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 5599
UniProt: P45983
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
Target-Kategorie: MAPK8
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200