[KO Validated] CDK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0294T
Artikelname: [KO Validated] CDK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0294T
Hersteller Artikelnummer: CNA0294T
Alternativnummer: MBL-CNA0294T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-298 of human CDK2 (NP_001789.2).
Konjugation: Unconjugated
Alternative Synonym: CDKN2, p33(CDK2)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 1017
UniProt: P24941
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Target-Kategorie: CDK2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200