ESRalpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0296P
Artikelname: ESRalpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0296P
Hersteller Artikelnummer: CNA0296P
Alternativnummer: MBL-CNA0296P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence within amino acids 516-595 of human ESRalpha (NP_000116.2).
Konjugation: Unconjugated
Alternative Synonym: ER, ESR, Era, ESRA, ESTRR, NR3A1
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 2099
UniProt: P03372
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Target-Kategorie: ESR1
Application Verdünnung: WB: WB,1:100 - 1:500