RYR2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0298P
Artikelname: RYR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0298P
Hersteller Artikelnummer: CNA0298P
Alternativnummer: MBL-CNA0298P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 4200-4300 of human RYR2 (NP_001026.2).
Konjugation: Unconjugated
Alternative Synonym: RyR, ARVC2, ARVD2, RYR-2, VTSIP, VACRDS
Klonalität: Polyclonal
Molekulargewicht: 565kDa
NCBI: 6262
UniProt: Q92736
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MQLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVRSALFALRYNILTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVAS
Target-Kategorie: RYR2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200