CRM1/XPO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA0299P
| Artikelname: |
CRM1/XPO1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA0299P |
| Hersteller Artikelnummer: |
CNA0299P |
| Alternativnummer: |
MBL-CNA0299P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human CRM1/CRM1/XPO1 (NP_003391.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
emb, CRM1, exp1, CRM-1 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
123kDa |
| NCBI: |
7514 |
| UniProt: |
O14980 |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
GLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD |
| Target-Kategorie: |
XPO1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
