IGF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0303P
Artikelname: IGF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0303P
Hersteller Artikelnummer: CNA0303P
Alternativnummer: MBL-CNA0303P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1).
Konjugation: Unconjugated
Alternative Synonym: IGF, MGF, IGFI, IGF-I
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 3479
UniProt: P05019
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN
Target-Kategorie: IGF1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200