APOE Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0304P
Artikelname: APOE Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0304P
Hersteller Artikelnummer: CNA0304P
Alternativnummer: MBL-CNA0304P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-307 of human APOE (NP_000032.1).
Konjugation: Unconjugated
Alternative Synonym: AD2, LPG, APO-E, ApoE4, LDLCQ5
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 348
UniProt: P02649
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW
Target-Kategorie: APOE
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200