Src Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0324T
Artikelname: Src Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0324T
Hersteller Artikelnummer: CNA0324T
Alternativnummer: MBL-CNA0324T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 410-536 of human Src (NP_005408.1).
Konjugation: Unconjugated
Alternative Synonym: ASV, SRC1, THC6, c-SRC, p60-Src
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 6714
UniProt: P12931
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Target-Kategorie: SRC
Application Verdünnung: WB: WB,1:500 - 1:1000