CD79a Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0331T
Artikelname: CD79a Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0331T
Hersteller Artikelnummer: CNA0331T
Alternativnummer: MBL-CNA0331T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).
Konjugation: Unconjugated
Alternative Synonym: IGA, MB1, MB-1, IGAlpha
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 973
UniProt: P11912
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
Target-Kategorie: CD79A
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200