TGFA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0337S
Artikelname: TGFA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0337S
Hersteller Artikelnummer: CNA0337S
Alternativnummer: MBL-CNA0337S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1).
Konjugation: Unconjugated
Alternative Synonym: TFGA
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 7039
UniProt: P01135
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQA
Target-Kategorie: TGFA
Application Verdünnung: WB: WB,1:100 - 1:500