CD117/c-Kit Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0357P
Artikelname: CD117/c-Kit Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0357P
Hersteller Artikelnummer: CNA0357P
Alternativnummer: MBL-CNA0357P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 867-976 of human KIT (P10721).
Konjugation: Unconjugated
Alternative Synonym: PBT, SCFR, C-Kit, CD117, MASTC
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 3815
UniProt: P10721
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: VDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
Target-Kategorie: KIT
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200