TP73 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0385T
Artikelname: TP73 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0385T
Hersteller Artikelnummer: CNA0385T
Alternativnummer: MBL-CNA0385T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human TP73 (NP_005418.1).
Konjugation: Unconjugated
Alternative Synonym: P73, CILD47
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 7161
UniProt: O15350
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Target-Kategorie: TP73
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200