IGFBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0403S
Artikelname: IGFBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0403S
Hersteller Artikelnummer: CNA0403S
Alternativnummer: MBL-CNA0403S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IGFBP2 (NP_000588.2).
Konjugation: Unconjugated
Alternative Synonym: IBP2, IGF-BP53
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 3485
UniProt: P18065
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTE
Target-Kategorie: IGFBP2
Application Verdünnung: WB: WB,1:500 - 1:2000