FGFR3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0404P
Artikelname: FGFR3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0404P
Hersteller Artikelnummer: CNA0404P
Alternativnummer: MBL-CNA0404P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-806 of human FGFR3 (NP_000133.1).
Konjugation: Unconjugated
Alternative Synonym: ACH, CEK2, JTK4, CD333, HSFGFR3EX
Klonalität: Polyclonal
Molekulargewicht: 88kDa
NCBI: 2261
UniProt: P22607
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: VEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT
Target-Kategorie: FGFR3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200