Hsc70/HSPA8 Rabbit mAb, Clone: [ARC0258], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA0415S
| Artikelname: |
Hsc70/HSPA8 Rabbit mAb, Clone: [ARC0258], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA0415S |
| Hersteller Artikelnummer: |
CNA0415S |
| Alternativnummer: |
MBL-CNA0415S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0258] |
| Molekulargewicht: |
71kDa |
| NCBI: |
3312 |
| UniProt: |
P11142 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD |
| Target-Kategorie: |
HSPA8 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
