Activator protein 2 (AP-2/TFAP2A) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0416T
Artikelname: Activator protein 2 (AP-2/TFAP2A) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0416T
Hersteller Artikelnummer: CNA0416T
Alternativnummer: MBL-CNA0416T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human Activator protein 2 (AP-2/TFAP2A) (NP_003211.1).
Konjugation: Unconjugated
Alternative Synonym: AP-2, BOFS, AP2TF, TFAP2, AP-2alpha
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 7020
UniProt: P05549
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNL
Target-Kategorie: TFAP2A
Application Verdünnung: WB: WB,1:500 - 1:1000